PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.5356s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 659aa    MW: 73357.4 Da    PI: 6.6605
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.5356s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.4e-094234601954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  SapurV1A.5356s0010.1.p 423 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 460
                             554459******************************88 PP

2BELL117.37.3e-38285355272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             + elqk+k+kLls+leeVd+rY++y++q+++v+ssFeavag g+a +Y slA+ka+SrhFrcL+d i+ qi
  SapurV1A.5356s0010.1.p 285 FIELQKRKTKLLSMLEEVDRRYRHYRDQMKAVVSSFEAVAGTGAASVYSSLASKAMSRHFRCLRDGIVAQI 355
                             689******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-58223353IPR006563POX domain
PfamPF075265.6E-45229351IPR006563POX domain
PROSITE profilePS5007112.179401464IPR001356Homeobox domain
SMARTSM003895.8E-9404468IPR001356Homeobox domain
CDDcd000862.38E-11404465No hitNo description
SuperFamilySSF466895.99E-17405470IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27407470IPR009057Homeodomain-like
PfamPF059208.8E-18421460IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MARELCENKS TSMVSSGSFC YTDGSSSNPA IQTHLVNQIH GFESNPEMFN LTTGMEMIGF  60
SKNLQQQKSD SNSSMWKGFF NKPPNTINPG GPSSSKTIND STSGVFYQHE FSKPDFSTGI  120
SDSSNENLMA GPDHSAPWQE NRLLVDDSSL RCVFPCEGNE RPSQGLSLSL CSSNPSSIGL  180
QPFELRHTPT NQNQDNQQEE MRSFGKSPAN IQQQMMQAAN LHHQGQFQLR SSKFMGPAQD  240
LLNEFCSLGT KQGDELKQKF HKPKQWDDDQ NGSSSRKPPL QSLEFIELQK RKTKLLSMLE  300
EVDRRYRHYR DQMKAVVSSF EAVAGTGAAS VYSSLASKAM SRHFRCLRDG IVAQIHAAQK  360
ATGEKDPVAP GTTRGETPRL KVLDQALRQQ RAFQQMSMME SHPWRPQRGL PERSVSVLRA  420
WLFEHFLHPY PSDVDKHILA RQTGLSRSQV SNWFINARVR LWKPMVEEMY LEETKEQDNS  480
MASSDGVTGL DENINGRPNQ NPSSTDQKPT PDQLIRIDSE CLSSIISNPD KNDTNNSTKT  540
FQSHHVQHQQ QNFGNFGAME LDFSSYNHHT AAGVSYANDS VNNQNFNGGG VSLTLGLQQH  600
GGSGVGLAFS PASQSSLFYP RDLIEDCQQV QYSLLDGEGQ NLPYRNLMGA QLLHDLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15410468563Homeobox protein Meis2
3k2a_B2e-15410468563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029331.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-152BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLB9GKE50.0B9GKE5_POPTR; Uncharacterized protein
STRINGPOPTR_0001s09720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-147TALE family protein